(data stored in ACNUC1104 zone)

EMBL: AM420293.PE237

AM420293.PE237       Location/Qualifiers
FT   CDS             complement(276588..277157)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0240a"
FT                   /note="Xis like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0240a"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99592"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B8"
FT                   /protein_id="CAL99592.1"
FT                   /translation="MTTAAMSPSRPTPRVGGGAVPAVPAVPPQVSAGRQHALGRHEPSH
FT                   SCKPSQPDQHRDAWDGWDGYPPHPVLPDRGWPVNGPVSPAGASEYPLAIHLPGPLGATC
FT                   ANASPVGKWMPGGSGVDAPIQGGFPPTRPPTHSTTRHQPQPRPGGWVDLVDTPRGDAPA
FT                   RLCRGGPHRPPTRSNRPPSTTPGDPR"
     MTTAAMSPSR PTPRVGGGAV PAVPAVPPQV SAGRQHALGR HEPSHSCKPS QPDQHRDAWD        60
     GWDGYPPHPV LPDRGWPVNG PVSPAGASEY PLAIHLPGPL GATCANASPV GKWMPGGSGV       120
     DAPIQGGFPP TRPPTHSTTR HQPQPRPGGW VDLVDTPRGD APARLCRGGP HRPPTRSNRP       180
     PSTTPGDPR                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page