(data stored in ACNUC1104 zone)

EMBL: AM420293.PE238

AM420293.PE238       Location/Qualifiers
FT   CDS             complement(277154..277384)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99593"
FT                   /db_xref="GOA:A4F6B9"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B9"
FT                   /protein_id="CAL99593.1"
FT                   /translation="MSTSTPASLPRPREAGDATRLLLTVEQAARRLSVGRTTMFKLIKS
FT                   GDVDSVRIGHARRVPAEALTAYINRLARNAA"
     MSTSTPASLP RPREAGDATR LLLTVEQAAR RLSVGRTTMF KLIKSGDVDS VRIGHARRVP        60
     AEALTAYINR LARNAA                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page