(data stored in ACNUC1104 zone)

EMBL: AM420293.PE241

AM420293.PE241       Location/Qualifiers
FT   CDS             complement(280464..280841)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99596"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C2"
FT                   /protein_id="CAL99596.1"
FT                   /translation="MGVRLREYRKARCWSQNIACKHLIAVADRQGLRIHSWGTLLGLLS
FT                   EWERGVRVVSATYQELFAEVYGTTPEMLGIAGSWSRNHPVVTRADIDRGAPMTQVISSP
FT                   KDPLIGGLSGAERIELEGAAA"
     MGVRLREYRK ARCWSQNIAC KHLIAVADRQ GLRIHSWGTL LGLLSEWERG VRVVSATYQE        60
     LFAEVYGTTP EMLGIAGSWS RNHPVVTRAD IDRGAPMTQV ISSPKDPLIG GLSGAERIEL       120
     EGAAA                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page