(data stored in ACNUC1104 zone)

EMBL: AM420293.PE243

AM420293.PE243       Location/Qualifiers
FT   CDS             complement(281249..281494)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99598"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C4"
FT                   /protein_id="CAL99598.1"
FT                   /translation="MYRVKAVAEMFDVSVNTIYRAIESGELDAMKLGTGKGTIRIPGWA
FT                   LSVYAEKCSQAAYEAFVTGTESAAADDRDETAGEVA"
     MYRVKAVAEM FDVSVNTIYR AIESGELDAM KLGTGKGTIR IPGWALSVYA EKCSQAAYEA        60
     FVTGTESAAA DDRDETAGEV A                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page