(data stored in ACNUC1104 zone)

EMBL: AM420293.PE247

AM420293.PE247       Location/Qualifiers
FT   CDS             288163..288393
FT                   /transl_table=11
FT                   /locus_tag="SACE_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99602"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C8"
FT                   /protein_id="CAL99602.1"
FT                   /translation="MGLAYRWLGTGPSTVGPGLSIGRGRARCERSRPVTEVIDDQCVER
FT                   DRLTALIDDLVESRRGLDELIDQTRADAATA"
     MGLAYRWLGT GPSTVGPGLS IGRGRARCER SRPVTEVIDD QCVERDRLTA LIDDLVESRR        60
     GLDELIDQTR ADAATA                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page