(data stored in ACNUC1104 zone)

EMBL: AM420293.PE249

AM420293.PE249       Location/Qualifiers
FT   CDS             290359..290709
FT                   /transl_table=11
FT                   /locus_tag="SACE_0254"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99604"
FT                   /db_xref="GOA:A4F6D0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F6D0"
FT                   /protein_id="CAL99604.1"
FT                   /translation="MQPGGQPNMQQIMEQAQKMQQQLMTAQQELAEAEVSGSAGGGLVT
FT                   AVVSGSGELKSVAIDPKAVDPDDTDTLSDLVVAAVRDANRAAQELQQEKMGPVTGALGG
FT                   GQGLGGLGLPGL"
     MQPGGQPNMQ QIMEQAQKMQ QQLMTAQQEL AEAEVSGSAG GGLVTAVVSG SGELKSVAID        60
     PKAVDPDDTD TLSDLVVAAV RDANRAAQEL QQEKMGPVTG ALGGGQGLGG LGLPGL           116
//

If you have problems or comments...

PBIL Back to PBIL home page