(data stored in ACNUC1104 zone)

EMBL: AM420293.PE251

AM420293.PE251       Location/Qualifiers
FT   CDS             291661..292185
FT                   /transl_table=11
FT                   /locus_tag="SACE_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99606"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D2"
FT                   /protein_id="CAL99606.1"
FT                   /translation="MRLVAVDGPSGSGKSVFARGLVAALRADGLRTALVPTDDFATWDE
FT                   PVGWWPRLAEGVLDPLRRGEPGRYQRTEWPGGEPVLGAWVDVEVPDVLVVEGVSSARRA
FT                   VADRLSLAIWVEVGDPALRLERAVARDGEWSRPHLLRWQEFERRWFAEDGAKHRADILR
FT                   QRSSPLSRQRR"
     MRLVAVDGPS GSGKSVFARG LVAALRADGL RTALVPTDDF ATWDEPVGWW PRLAEGVLDP        60
     LRRGEPGRYQ RTEWPGGEPV LGAWVDVEVP DVLVVEGVSS ARRAVADRLS LAIWVEVGDP       120
     ALRLERAVAR DGEWSRPHLL RWQEFERRWF AEDGAKHRAD ILRQRSSPLS RQRR             174
//

If you have problems or comments...

PBIL Back to PBIL home page