(data stored in SCRATCH zone)

EMBL: AM420293.PE255

AM420293.PE255       Location/Qualifiers
FT   CDS             296112..297104
FT                   /transl_table=11
FT                   /locus_tag="SACE_0260"
FT                   /product="oligopeptide ABC transporter ATP-binding protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99610"
FT                   /db_xref="GOA:A4F6D6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D6"
FT                   /protein_id="CAL99610.1"
FT                   /translation="MALLEVRDLSVVFARKGEPPVTAVDGISFDVEPGRTVGLVGESGC
FT                   GKSVTSLAIMGLLPPRGAEVSGSITFDGTELLGLSRQELDKRRGRDLSMVFQDPLTSLN
FT                   PVVSIGVQVAEVIERHRGLPRKKAMPEAEELLAKVGIPDPRRRLREYPHQLSGGMRQRA
FT                   LIAMALACRPRLLIADEPTTALDVTIQAQILNLLTKLVAETDTALIMITHDLGVVAGLC
FT                   DEVNVLYAGRVVERAARHELFARPRHPYTAGLLSSIPRLDATRGQKLTPIRGSISDNIP
FT                   WDAGCAFCPRCPNALEVCQQQTPEVSVDVGARLLRCHNPVRESSSMEVS"
     MALLEVRDLS VVFARKGEPP VTAVDGISFD VEPGRTVGLV GESGCGKSVT SLAIMGLLPP        60
     RGAEVSGSIT FDGTELLGLS RQELDKRRGR DLSMVFQDPL TSLNPVVSIG VQVAEVIERH       120
     RGLPRKKAMP EAEELLAKVG IPDPRRRLRE YPHQLSGGMR QRALIAMALA CRPRLLIADE       180
     PTTALDVTIQ AQILNLLTKL VAETDTALIM ITHDLGVVAG LCDEVNVLYA GRVVERAARH       240
     ELFARPRHPY TAGLLSSIPR LDATRGQKLT PIRGSISDNI PWDAGCAFCP RCPNALEVCQ       300
     QQTPEVSVDV GARLLRCHNP VRESSSMEVS                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page