(data stored in ACNUC1104 zone)

EMBL: AM420293.PE257

AM420293.PE257       Location/Qualifiers
FT   CDS             298358..298561
FT                   /transl_table=11
FT                   /locus_tag="SACE_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99612"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D8"
FT                   /protein_id="CAL99612.1"
FT                   /translation="MRRSAIGRHDGVMGFKLRKSFRIGPLVLHVTQRGLSSWGLKVGRW
FT                   SWNAKTRKHTFDTPGPGYWQSK"
     MRRSAIGRHD GVMGFKLRKS FRIGPLVLHV TQRGLSSWGL KVGRWSWNAK TRKHTFDTPG        60
     PGYWQSK                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page