(data stored in ACNUC1104 zone)

EMBL: AM420293.PE258

AM420293.PE258       Location/Qualifiers
FT   CDS             complement(298598..299494)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0263"
FT                   /product="probable amino acid metabolite transport protein"
FT                   /function="7 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99613"
FT                   /db_xref="GOA:A4F6D9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D9"
FT                   /protein_id="CAL99613.1"
FT                   /translation="MALFVVLLWGVNFIAIDFGLQHFPPLFFGGLRFALIALPTILFVP
FT                   RPKVRWQWLVGYGLGFGTLQFAFLFVAIEVGMPTGLASLVLQASAPFTVILGALLLRER
FT                   LNALQGLGIAIAVLGMVAIGWNRAQDAALLPVVLTLLGALGWAFGNLCNRKANPQNPLH
FT                   LALWMSVVPPLPMFALSAFVEGPVVGWQAVWTSFTTQTGLYALCGLAYIIVFATVIGSG
FT                   VWTALMGRNPASSVAPFTLLVPVVGFTSAWLVLNEQPDPFELVAGAVVVGGVLLGSIRR
FT                   GKPVELPEPEPVLTPAR"
     MALFVVLLWG VNFIAIDFGL QHFPPLFFGG LRFALIALPT ILFVPRPKVR WQWLVGYGLG        60
     FGTLQFAFLF VAIEVGMPTG LASLVLQASA PFTVILGALL LRERLNALQG LGIAIAVLGM       120
     VAIGWNRAQD AALLPVVLTL LGALGWAFGN LCNRKANPQN PLHLALWMSV VPPLPMFALS       180
     AFVEGPVVGW QAVWTSFTTQ TGLYALCGLA YIIVFATVIG SGVWTALMGR NPASSVAPFT       240
     LLVPVVGFTS AWLVLNEQPD PFELVAGAVV VGGVLLGSIR RGKPVELPEP EPVLTPAR         298
//

If you have problems or comments...

PBIL Back to PBIL home page