(data stored in ACNUC1104 zone)

EMBL: AM420293.PE260

AM420293.PE260       Location/Qualifiers
FT   CDS             complement(300493..302007)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0265"
FT                   /product="two component system histidine kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99615"
FT                   /db_xref="GOA:A4F6E1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E1"
FT                   /protein_id="CAL99615.1"
FT                   /translation="MRIVVALMVVTTTATVAMAFAAYRLQATGTTDRFNAAASAGFLSD
FT                   LSQAQARYRTAAEPKDRIKTVADYMIGRKGLHWSVVDFMPSANGPAPGPVWLLEGPDYY
FT                   YGPQLRPEHVDASSLRFEGFPEPAFVATTTPWVNRTAGLVARARTGGTTTETVPVEGGG
FT                   QLLAFASRVGPDLVLVEFYDMQPLHSELSQLRNALAVVALGVSALGVVLALLAAASVQR
FT                   PVRKVAAAAHRIGEGAFDTRLPVRGKDEIAELTSAFNTMAQRLGDSIEELRVKDRQQQR
FT                   FVADVAHDLRTPTASLVAAADSLEHPDPESRSRAVALVSTQARRLARLVDDLLEISRFD
FT                   SGAAELRPEGVDLRELVREAIELVTCDADVRLDATADTTLVGDPRRLHTIVCNLLANAV
FT                   HHGAEPVTVAIDGTDPGQVVLRVADSGPGVPEELTRILFDRFVRGDRARSATDGSGLGM
FT                   AIAQQNALVHGGRITVHNDGGAVFTLTLPRGDRSATGSDAPGPSTA"
     MRIVVALMVV TTTATVAMAF AAYRLQATGT TDRFNAAASA GFLSDLSQAQ ARYRTAAEPK        60
     DRIKTVADYM IGRKGLHWSV VDFMPSANGP APGPVWLLEG PDYYYGPQLR PEHVDASSLR       120
     FEGFPEPAFV ATTTPWVNRT AGLVARARTG GTTTETVPVE GGGQLLAFAS RVGPDLVLVE       180
     FYDMQPLHSE LSQLRNALAV VALGVSALGV VLALLAAASV QRPVRKVAAA AHRIGEGAFD       240
     TRLPVRGKDE IAELTSAFNT MAQRLGDSIE ELRVKDRQQQ RFVADVAHDL RTPTASLVAA       300
     ADSLEHPDPE SRSRAVALVS TQARRLARLV DDLLEISRFD SGAAELRPEG VDLRELVREA       360
     IELVTCDADV RLDATADTTL VGDPRRLHTI VCNLLANAVH HGAEPVTVAI DGTDPGQVVL       420
     RVADSGPGVP EELTRILFDR FVRGDRARSA TDGSGLGMAI AQQNALVHGG RITVHNDGGA       480
     VFTLTLPRGD RSATGSDAPG PSTA                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page