(data stored in ACNUC1104 zone)

EMBL: AM420293.PE264

AM420293.PE264       Location/Qualifiers
FT   CDS             303960..304256
FT                   /transl_table=11
FT                   /locus_tag="SACE_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99619"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E5"
FT                   /protein_id="CAL99619.1"
FT                   /translation="MFADEGSARCGTVLPTAYRSDVVFWIVPVGEDVRHGTTTRPGALP
FT                   AGSEVLVLCARRFKLPTSTPWPDVPKTKSVTRQCEDCVAEYERLGRPATVWDF"
     MFADEGSARC GTVLPTAYRS DVVFWIVPVG EDVRHGTTTR PGALPAGSEV LVLCARRFKL        60
     PTSTPWPDVP KTKSVTRQCE DCVAEYERLG RPATVWDF                                98
//

If you have problems or comments...

PBIL Back to PBIL home page