(data stored in ACNUC1104 zone)

EMBL: AM420293.PE267

AM420293.PE267       Location/Qualifiers
FT   CDS             306896..307582
FT                   /transl_table=11
FT                   /locus_tag="SACE_0273"
FT                   /product="integral membrane protein"
FT                   /function="uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99622"
FT                   /db_xref="GOA:A4F6E8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E8"
FT                   /protein_id="CAL99622.1"
FT                   /translation="MIEWLESIPPVAIYLAVGLIIGLESVGIPLPGEILLVSASVAASQ
FT                   GMVNPVLLGCIAATGAIIGDSVGYAVGKKYGRGLLTRLGRRMPKHFGPKRIAAAERAFD
FT                   RWGAWAVFGGRFVALLRILAGPLAGILGMQYRKFLLANATGGIAWAGTVTTVAYLFGVV
FT                   AEHWIKRFSWVALLITVLIGVAITLYVRHRTERAVEAEEAAEADGAADAASPEEAAEAL
FT                   SGTEKA"
     MIEWLESIPP VAIYLAVGLI IGLESVGIPL PGEILLVSAS VAASQGMVNP VLLGCIAATG        60
     AIIGDSVGYA VGKKYGRGLL TRLGRRMPKH FGPKRIAAAE RAFDRWGAWA VFGGRFVALL       120
     RILAGPLAGI LGMQYRKFLL ANATGGIAWA GTVTTVAYLF GVVAEHWIKR FSWVALLITV       180
     LIGVAITLYV RHRTERAVEA EEAAEADGAA DAASPEEAAE ALSGTEKA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page