(data stored in SCRATCH zone)

EMBL: AM420293.PE269

AM420293.PE269       Location/Qualifiers
FT   CDS             309847..310128
FT                   /transl_table=11
FT                   /locus_tag="SACE_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99624"
FT                   /db_xref="GOA:A4F6F0"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F0"
FT                   /protein_id="CAL99624.1"
FT                   /translation="MAAKRGRSGVATLINGAGFVIAAMLVLHIVFVLTGFPTENGLAGS
FT                   VRQAAEPLALFFPGMVDAGDEVLQVMADFGLAAVFWVLVTGLLARVFG"
     MAAKRGRSGV ATLINGAGFV IAAMLVLHIV FVLTGFPTEN GLAGSVRQAA EPLALFFPGM        60
     VDAGDEVLQV MADFGLAAVF WVLVTGLLAR VFG                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page