(data stored in ACNUC1104 zone)

EMBL: AM420293.PE270

AM420293.PE270       Location/Qualifiers
FT   CDS             310397..310771
FT                   /transl_table=11
FT                   /locus_tag="SACE_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99625"
FT                   /db_xref="GOA:A4F6F1"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F1"
FT                   /protein_id="CAL99625.1"
FT                   /translation="MSESDSAAGTHEVGGGRRRRHRSFDAARARVRVAGALIAVVRWIG
FT                   TLAAALLALHVVLTLGGANPDNSIARFVADWAQPLALGFSDLFVPQDPQLAILLNYGIA
FT                   ALFWLVATSIAVRILRLIAR"
     MSESDSAAGT HEVGGGRRRR HRSFDAARAR VRVAGALIAV VRWIGTLAAA LLALHVVLTL        60
     GGANPDNSIA RFVADWAQPL ALGFSDLFVP QDPQLAILLN YGIAALFWLV ATSIAVRILR       120
     LIAR                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page