(data stored in ACNUC1104 zone)

EMBL: AM420293.PE275

AM420293.PE275       Location/Qualifiers
FT   CDS             complement(313597..314817)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0281"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99630"
FT                   /db_xref="GOA:A4F6F6"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F6"
FT                   /protein_id="CAL99630.1"
FT                   /translation="MDPQRCNTAETVRNQQKRPGDHRLAAVREALREHRRGLLLVAPGV
FT                   VYLAIRFFGLLVLAWLSAANDESLSDNLGAWDGEWYLEIAEHDYGGVDPGMVDGFGNRY
FT                   PETPLAFFPGYPLLVRLFGLLPGVSALGAAITVSLLCGVVAAYGLARLGKRIGGSEGTG
FT                   LLLVVLFAAAPMSVVLSMAYSEALFCALSIWALIGVVERKWLLAGLCCAAAGLVRPTAA
FT                   ALIAVVGLAALIAIVRRRELWRPLLAMLLAPIGMLAYVGWVGLQTGKLGGYFELQQRGW
FT                   SSAFDGGVRTTEFVVETLTADKSVLETFTAWIVLAALVLFVLCLRYRMPWPLVLFAAAV
FT                   LVLDLGSDGLMYSKVRLMLPAFPLLVPVAIGLANRRTTTAVCTAVLLVCFGSWFGAYSL
FT                   TAWPYAM"
     MDPQRCNTAE TVRNQQKRPG DHRLAAVREA LREHRRGLLL VAPGVVYLAI RFFGLLVLAW        60
     LSAANDESLS DNLGAWDGEW YLEIAEHDYG GVDPGMVDGF GNRYPETPLA FFPGYPLLVR       120
     LFGLLPGVSA LGAAITVSLL CGVVAAYGLA RLGKRIGGSE GTGLLLVVLF AAAPMSVVLS       180
     MAYSEALFCA LSIWALIGVV ERKWLLAGLC CAAAGLVRPT AAALIAVVGL AALIAIVRRR       240
     ELWRPLLAML LAPIGMLAYV GWVGLQTGKL GGYFELQQRG WSSAFDGGVR TTEFVVETLT       300
     ADKSVLETFT AWIVLAALVL FVLCLRYRMP WPLVLFAAAV LVLDLGSDGL MYSKVRLMLP       360
     AFPLLVPVAI GLANRRTTTA VCTAVLLVCF GSWFGAYSLT AWPYAM                      406
//

If you have problems or comments...

PBIL Back to PBIL home page