(data stored in ACNUC1104 zone)

EMBL: AM420293.PE28

AM420293.PE28        Location/Qualifiers
FT   CDS             complement(49905..50441)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0030"
FT                   /product="probable ATP-dependent Clp protease ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99383"
FT                   /db_xref="GOA:A4F5Q9"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q9"
FT                   /protein_id="CAL99383.1"
FT                   /translation="MFERFTRTARDTVVRAVEEAKRAEAAEVTAEHLALALLATPCGAL
FT                   LAEHGVRREDIASAYETARRRAGLSESDASALRALAIEVDHVVGSVEGAHGTGAMVPRG
FT                   RRRRFAPRGHVPVAADTKEVLRRCLREAVDMGDRQLDDRHLLLGLVTTCGVAADLLDEH
FT                   GIDYASLRARRRKAS"
     MFERFTRTAR DTVVRAVEEA KRAEAAEVTA EHLALALLAT PCGALLAEHG VRREDIASAY        60
     ETARRRAGLS ESDASALRAL AIEVDHVVGS VEGAHGTGAM VPRGRRRRFA PRGHVPVAAD       120
     TKEVLRRCLR EAVDMGDRQL DDRHLLLGLV TTCGVAADLL DEHGIDYASL RARRRKAS         178
//

If you have problems or comments...

PBIL Back to PBIL home page