(data stored in SCRATCH zone)

EMBL: AM420293.PE280

AM420293.PE280       Location/Qualifiers
FT   CDS             319260..319814
FT                   /transl_table=11
FT                   /locus_tag="SACE_0286"
FT                   /product="protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99635"
FT                   /db_xref="GOA:A4F6G1"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G1"
FT                   /protein_id="CAL99635.1"
FT                   /translation="MSWPGHLLTLEEFDQLPEDNSRRYELQEGVLLVTPKAATLHQRVV
FT                   RALGSVLVAQLPAEWEAVPDVEVVLKHKWPPTVRIPDVLIAPTELIDKNPNRLQAADVA
FT                   VAVEVISPGSRQMDQVTKRYEYAAAGIQGYWVLETDDVVKLTASRLIGEVYEVDFCGGG
FT                   MFKTAHPFELTLDLDTLIKRA"
     MSWPGHLLTL EEFDQLPEDN SRRYELQEGV LLVTPKAATL HQRVVRALGS VLVAQLPAEW        60
     EAVPDVEVVL KHKWPPTVRI PDVLIAPTEL IDKNPNRLQA ADVAVAVEVI SPGSRQMDQV       120
     TKRYEYAAAG IQGYWVLETD DVVKLTASRL IGEVYEVDFC GGGMFKTAHP FELTLDLDTL       180
     IKRA                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page