(data stored in ACNUC1104 zone)

EMBL: AM420293.PE281

AM420293.PE281       Location/Qualifiers
FT   CDS             complement(319930..320421)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0287"
FT                   /product="starvation-response DNA binding protein"
FT                   /function="DNA-binding ferritin-like protein (oxidative
FT                   damage protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99636"
FT                   /db_xref="GOA:A4F6G2"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G2"
FT                   /protein_id="CAL99636.1"
FT                   /translation="MATKTAAKAPITSALNDSDRDVTGKALQGTLLDLIDLHLVAKQAH
FT                   WNVVGKFFRDVHLQLDELIDTARAFADDVAERASAIGVSPDGRSSTVASGSGMPKFDAG
FT                   WKNDREVIEYIVSALSELISRVRMRIDETDKTDLVTQDLLLSIASELEKSHWMWQAQLA
FT                   "
     MATKTAAKAP ITSALNDSDR DVTGKALQGT LLDLIDLHLV AKQAHWNVVG KFFRDVHLQL        60
     DELIDTARAF ADDVAERASA IGVSPDGRSS TVASGSGMPK FDAGWKNDRE VIEYIVSALS       120
     ELISRVRMRI DETDKTDLVT QDLLLSIASE LEKSHWMWQA QLA                         163
//

If you have problems or comments...

PBIL Back to PBIL home page