(data stored in ACNUC1104 zone)

EMBL: AM420293.PE288

AM420293.PE288       Location/Qualifiers
FT   CDS             328646..330109
FT                   /transl_table=11
FT                   /locus_tag="SACE_0294"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99643"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G9"
FT                   /protein_id="CAL99643.1"
FT                   /translation="MPHSQPEGRAETFASSPGTQSGADQPTLHEFLTRLVSDPAARSAF
FT                   DADPHATLDQAGLGGMTATDVLQAASLVLDYAPVEVVQEYDRSLQSSVEKFAASTQHVA
FT                   INQLHPVHPLEQEELTMLHNSSPQAPDFSQGGDVDKLMPAPEAKGGDVNVDIEQNDSHN
FT                   LISVHHIASDNNIGNIAAVGNVVGDVVGDTANTVVGTVGDVAYGSVSQVTNTVDNSVDV
FT                   GGDLVAGAGSALIGGDVNIQPVNEVTNVVGDVTGVAGDLTGGDVTDVAGNVTGVAGDLP
FT                   VVGDVAGTVGGVAGGLPVVGDVAGAAGSGELPVVGDVAGTVGGVAGGLPVVGDVAGAAG
FT                   SGELPAVGDVAGTVGGVTDLAGGVTGGLPVVGDVAPAISDPAALPVVGDVAGELPVDDV
FT                   AGALPVDDVADTVGGVTDTVGGVTSSLPVDDVTSHLPVEDVTSNLPVNDVTSHLPAPSD
FT                   LPVVGPVAGGAVEQIAGEATSALPLDGLL"
     MPHSQPEGRA ETFASSPGTQ SGADQPTLHE FLTRLVSDPA ARSAFDADPH ATLDQAGLGG        60
     MTATDVLQAA SLVLDYAPVE VVQEYDRSLQ SSVEKFAAST QHVAINQLHP VHPLEQEELT       120
     MLHNSSPQAP DFSQGGDVDK LMPAPEAKGG DVNVDIEQND SHNLISVHHI ASDNNIGNIA       180
     AVGNVVGDVV GDTANTVVGT VGDVAYGSVS QVTNTVDNSV DVGGDLVAGA GSALIGGDVN       240
     IQPVNEVTNV VGDVTGVAGD LTGGDVTDVA GNVTGVAGDL PVVGDVAGTV GGVAGGLPVV       300
     GDVAGAAGSG ELPVVGDVAG TVGGVAGGLP VVGDVAGAAG SGELPAVGDV AGTVGGVTDL       360
     AGGVTGGLPV VGDVAPAISD PAALPVVGDV AGELPVDDVA GALPVDDVAD TVGGVTDTVG       420
     GVTSSLPVDD VTSHLPVEDV TSNLPVNDVT SHLPAPSDLP VVGPVAGGAV EQIAGEATSA       480
     LPLDGLL                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page