(data stored in ACNUC1104 zone)

EMBL: AM420293.PE292

AM420293.PE292       Location/Qualifiers
FT   CDS             complement(335026..335553)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99647"
FT                   /db_xref="GOA:A4F6H3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H3"
FT                   /protein_id="CAL99647.1"
FT                   /translation="MRQRLLTAAAELIPERGWTAVSTRVLAERAGVTPSVVHYHFPSLP
FT                   ALLNEAVVGLMRQMLADVDAFLSAAATPADAVDAMLESVDRYTGADPMSLLFVEACLAA
FT                   TRDEQLRGEIGAVVEEFRQRVGRWLGEHGVSAPAETAAALIAVVDGLLLHRGLGVGPDT
FT                   GSAARVLRRLVA"
     MRQRLLTAAA ELIPERGWTA VSTRVLAERA GVTPSVVHYH FPSLPALLNE AVVGLMRQML        60
     ADVDAFLSAA ATPADAVDAM LESVDRYTGA DPMSLLFVEA CLAATRDEQL RGEIGAVVEE       120
     FRQRVGRWLG EHGVSAPAET AAALIAVVDG LLLHRGLGVG PDTGSAARVL RRLVA            175
//

If you have problems or comments...

PBIL Back to PBIL home page