(data stored in ACNUC1104 zone)

EMBL: AM420293.PE293

AM420293.PE293       Location/Qualifiers
FT   CDS             complement(335945..336091)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99648"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H4"
FT                   /protein_id="CAL99648.1"
FT                   /translation="MCGRELAADNSQHAWFWGTCPDCNREAHRLAASRQEAQSRVQKCG
FT                   RRK"
     MCGRELAADN SQHAWFWGTC PDCNREAHRL AASRQEAQSR VQKCGRRK                     48
//

If you have problems or comments...

PBIL Back to PBIL home page