(data stored in ACNUC1104 zone)

EMBL: AM420293.PE295

AM420293.PE295       Location/Qualifiers
FT   CDS             337188..337376
FT                   /transl_table=11
FT                   /locus_tag="SACE_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99650"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H6"
FT                   /protein_id="CAL99650.1"
FT                   /translation="MKPENWRKSSRSQPNGNCVEVGGSAAGAAVRDSKDRDAGYFTASR
FT                   AQWSAFVGAVKAGRFDR"
     MKPENWRKSS RSQPNGNCVE VGGSAAGAAV RDSKDRDAGY FTASRAQWSA FVGAVKAGRF        60
     DR                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page