(data stored in SCRATCH zone)

EMBL: AM420293.PE30

AM420293.PE30        Location/Qualifiers
FT   CDS             complement(50707..51207)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99385"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R1"
FT                   /protein_id="CAL99385.1"
FT                   /translation="MSEQIELSFDIEATTEVDASPDEVYRVVSDITRMGEWSPECTGGE
FT                   WLRGQPGAAGSRFHGHNRAGGETWTTECEVVAAVPGREFAWAVLTYARSPEVSVWSFAI
FT                   EPDGDGCVLTQRYRMQEPPARFASFMRGMDADQAAALGAKRRAMLEDAMSRTVAGIKAA
FT                   VED"
     MSEQIELSFD IEATTEVDAS PDEVYRVVSD ITRMGEWSPE CTGGEWLRGQ PGAAGSRFHG        60
     HNRAGGETWT TECEVVAAVP GREFAWAVLT YARSPEVSVW SFAIEPDGDG CVLTQRYRMQ       120
     EPPARFASFM RGMDADQAAA LGAKRRAMLE DAMSRTVAGI KAAVED                      166
//

If you have problems or comments...

PBIL Back to PBIL home page