(data stored in ACNUC1104 zone)

EMBL: AM420293.PE312

AM420293.PE312       Location/Qualifiers
FT   CDS             complement(355446..355697)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99667"
FT                   /db_xref="GOA:A4F6J3"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J3"
FT                   /protein_id="CAL99667.1"
FT                   /translation="METWRIVATALITAVGGFMVLGIMSTVRARRDRAPGEVGRVALHG
FT                   GLVVVVLAALAATVLPPAVCWGLVAAGVLITVGVMITG"
     METWRIVATA LITAVGGFMV LGIMSTVRAR RDRAPGEVGR VALHGGLVVV VLAALAATVL        60
     PPAVCWGLVA AGVLITVGVM ITG                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page