(data stored in SCRATCH zone)

EMBL: AM420293.PE313

AM420293.PE313       Location/Qualifiers
FT   CDS             355821..355955
FT                   /transl_table=11
FT                   /locus_tag="SACE_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99668"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J4"
FT                   /protein_id="CAL99668.1"
FT                   /translation="MPLLSHATKQILDQWGEDGWELVAVLPGPTGEQMVAYMKRPKGD"
     MPLLSHATKQ ILDQWGEDGW ELVAVLPGPT GEQMVAYMKR PKGD                         44
//

If you have problems or comments...

PBIL Back to PBIL home page