(data stored in ACNUC1104 zone)

EMBL: AM420293.PE315

AM420293.PE315       Location/Qualifiers
FT   CDS             356787..357362
FT                   /transl_table=11
FT                   /locus_tag="SACE_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99670"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J6"
FT                   /protein_id="CAL99670.1"
FT                   /translation="MLLRLAGRLPDRHLWRYRDWLAGGAADVLARMLPGTLVRERIPLG
FT                   DGDFRLLRDALFPLGADPALVNAILPAKQTRPAHTFVATSHTDDSGDPAILVLGATLRG
FT                   RQGVREVRSSWRRGDGLPLKRVLLVTASADVVGLTSEIQRILRALGEPEPCVEVLPPDV
FT                   EPTAYHRAALAESALVCEGADELAGHRG"
     MLLRLAGRLP DRHLWRYRDW LAGGAADVLA RMLPGTLVRE RIPLGDGDFR LLRDALFPLG        60
     ADPALVNAIL PAKQTRPAHT FVATSHTDDS GDPAILVLGA TLRGRQGVRE VRSSWRRGDG       120
     LPLKRVLLVT ASADVVGLTS EIQRILRALG EPEPCVEVLP PDVEPTAYHR AALAESALVC       180
     EGADELAGHR G                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page