(data stored in ACNUC1104 zone)

EMBL: AM420293.PE317

AM420293.PE317       Location/Qualifiers
FT   CDS             complement(358670..360172)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0323"
FT                   /product="hypothetical protein"
FT                   /function="predicted dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99672"
FT                   /db_xref="GOA:A4F6J8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J8"
FT                   /protein_id="CAL99672.1"
FT                   /translation="MTQFDHGRSRSERSTRPAPARNPASESSRDTSAARTSAKAAVSLT
FT                   TVPGSAPARSTPDSSNVSRTAAHTSARASSSVHPSCLAHHCGEGPFHATEVSASRGSTP
FT                   PPGNTVMPPANGMPFTRRWRKTSGPAVPSRSSRTVAASFGVTGGSGGDSGTNPSGSASS
FT                   SGSCTMPVTLSRDDAENRDPGPEITASPQVPPSAGPPLRRRHDVGMSETLRVGVVGAGP
FT                   WAGRVHAPGLEAHPGTRLAAVWSRRREAAEELAGSRDVLVATGFDELLASVDAVAFAVP
FT                   PDVQAKLAPVAARAGKHLILEKPLATDLAGAQAVADAAQESGVAAVMMLTRRFAPEVRS
FT                   WLAGLDGVRGGAGRWLAGALLSGDYAASRWRQEEGALVDAGPHAIDLLDAALGRIEQVH
FT                   YASRDAANDLWHVVFGHEGGATSTLTLSLRVPVQPALVDISVYGENGHTQLSGRRTAAQ
FT                   DCYAVLLDEFLELVREGKTEHVCDVRRGLHLQRVLADVQAAV"
     MTQFDHGRSR SERSTRPAPA RNPASESSRD TSAARTSAKA AVSLTTVPGS APARSTPDSS        60
     NVSRTAAHTS ARASSSVHPS CLAHHCGEGP FHATEVSASR GSTPPPGNTV MPPANGMPFT       120
     RRWRKTSGPA VPSRSSRTVA ASFGVTGGSG GDSGTNPSGS ASSSGSCTMP VTLSRDDAEN       180
     RDPGPEITAS PQVPPSAGPP LRRRHDVGMS ETLRVGVVGA GPWAGRVHAP GLEAHPGTRL       240
     AAVWSRRREA AEELAGSRDV LVATGFDELL ASVDAVAFAV PPDVQAKLAP VAARAGKHLI       300
     LEKPLATDLA GAQAVADAAQ ESGVAAVMML TRRFAPEVRS WLAGLDGVRG GAGRWLAGAL       360
     LSGDYAASRW RQEEGALVDA GPHAIDLLDA ALGRIEQVHY ASRDAANDLW HVVFGHEGGA       420
     TSTLTLSLRV PVQPALVDIS VYGENGHTQL SGRRTAAQDC YAVLLDEFLE LVREGKTEHV       480
     CDVRRGLHLQ RVLADVQAAV                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page