(data stored in ACNUC1104 zone)

EMBL: AM420293.PE319

AM420293.PE319       Location/Qualifiers
FT   CDS             360500..361327
FT                   /transl_table=11
FT                   /locus_tag="SACE_0325"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /function="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99674"
FT                   /db_xref="GOA:A4F6K0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K0"
FT                   /protein_id="CAL99674.1"
FT                   /translation="MEHPAYGAVRPVTAYASVLLARNPDVMTLDGTNTWLVGSPDSADR
FT                   IVIDPGPADRDHLALAAERPVSVVLLTHHHPDHTAGARDFAGLTGAPVRALDPALCAGA
FT                   EPLTDGETVEASGVRLRVLATPGHTADSVCFTVDDPAEPAVFTGDTVLGKGTTVVAHPD
FT                   GHLGSYLESLRLLGDLPEGTRVLPGHGPELPDIRAVSRAYLAHRGQRLGQIRTVLREHG
FT                   PDITARGVVEIVYADVDPAVWPAAEWSVQAQLTYLRELEAPDGASSGPQGPSA"
     MEHPAYGAVR PVTAYASVLL ARNPDVMTLD GTNTWLVGSP DSADRIVIDP GPADRDHLAL        60
     AAERPVSVVL LTHHHPDHTA GARDFAGLTG APVRALDPAL CAGAEPLTDG ETVEASGVRL       120
     RVLATPGHTA DSVCFTVDDP AEPAVFTGDT VLGKGTTVVA HPDGHLGSYL ESLRLLGDLP       180
     EGTRVLPGHG PELPDIRAVS RAYLAHRGQR LGQIRTVLRE HGPDITARGV VEIVYADVDP       240
     AVWPAAEWSV QAQLTYLREL EAPDGASSGP QGPSA                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page