(data stored in ACNUC1104 zone)

EMBL: AM420293.PE322

AM420293.PE322       Location/Qualifiers
FT   CDS             complement(363781..364962)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0328"
FT                   /product="ABC transporter integral membrane protein"
FT                   /function="77 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99677"
FT                   /db_xref="GOA:A4F6K3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K3"
FT                   /protein_id="CAL99677.1"
FT                   /translation="MLTSLLARLPIAMVGLSLMLYVQRETGSFAAAGLVSAGALVGVAC
FT                   GSVVQGRVMDRIGPTLPLYVMSGVFAALVAAEIAVIEAHAPVAVLVALAFAVGISEPMT
FT                   GPASRALWNVLLPPGPARDAAFSYEAISMEVFFILGPGLAGLLVAMPWPGTGVVAGAAC
FT                   MIVGSVGFASTRAARSQRPERPERTGRGRSNMLGALASPGMRTVALAALGFGALIGFIE
FT                   VGVPAAAELAGHPTAGGLLLSLLSVSSVLVGVLYGMRPWPRAMHLRLPALLFGFAALIT
FT                   LLAVPTTLWGLALALLLAGSLITPQSTAHSVSLEIAAPAGTATEAFGWVVTSVTLGAAF
FT                   GQSVSGQIVETAGPPAAFLAASAVGALAALVLWLRRGTLRPEPAAASPQLAGV"
     MLTSLLARLP IAMVGLSLML YVQRETGSFA AAGLVSAGAL VGVACGSVVQ GRVMDRIGPT        60
     LPLYVMSGVF AALVAAEIAV IEAHAPVAVL VALAFAVGIS EPMTGPASRA LWNVLLPPGP       120
     ARDAAFSYEA ISMEVFFILG PGLAGLLVAM PWPGTGVVAG AACMIVGSVG FASTRAARSQ       180
     RPERPERTGR GRSNMLGALA SPGMRTVALA ALGFGALIGF IEVGVPAAAE LAGHPTAGGL       240
     LLSLLSVSSV LVGVLYGMRP WPRAMHLRLP ALLFGFAALI TLLAVPTTLW GLALALLLAG       300
     SLITPQSTAH SVSLEIAAPA GTATEAFGWV VTSVTLGAAF GQSVSGQIVE TAGPPAAFLA       360
     ASAVGALAAL VLWLRRGTLR PEPAAASPQL AGV                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page