(data stored in SCRATCH zone)

EMBL: AM420293.PE323

AM420293.PE323       Location/Qualifiers
FT   CDS             complement(365903..366472)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0329"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /function="cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99678"
FT                   /db_xref="GOA:A4F6K4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K4"
FT                   /protein_id="CAL99678.1"
FT                   /translation="MIFAEGEPGDRLYIIQSGKVKLGRKSPDGRENLLAIMGPSDMFGE
FT                   LSIFDPGPRTSTATTVTEVRALTMDRTALRQWIGTRPEIAEQLLRVVARRLRRTNGMLA
FT                   DLIFTDVPGRVAKALLQLAQRFGSQEAGLLRVTHDLTQEEIAQYVGASRETVNKALADF
FT                   AHRGWLRLEGKSVLILDPERLARRAR"
     MIFAEGEPGD RLYIIQSGKV KLGRKSPDGR ENLLAIMGPS DMFGELSIFD PGPRTSTATT        60
     VTEVRALTMD RTALRQWIGT RPEIAEQLLR VVARRLRRTN GMLADLIFTD VPGRVAKALL       120
     QLAQRFGSQE AGLLRVTHDL TQEEIAQYVG ASRETVNKAL ADFAHRGWLR LEGKSVLILD       180
     PERLARRAR                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page