(data stored in ACNUC1104 zone)

EMBL: AM420293.PE33

AM420293.PE33        Location/Qualifiers
FT   CDS             52773..53552
FT                   /transl_table=11
FT                   /locus_tag="SACE_0035"
FT                   /product="rhomboid-like protein"
FT                   /function="uncharacterized membrane protein (homolog of
FT                   Drosophila rhomboid)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99388"
FT                   /db_xref="GOA:A4F5R4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R4"
FT                   /protein_id="CAL99388.1"
FT                   /translation="MGYHCVDCVQAGRGGTRQAVTVAGARLAAKPVVVPVLIAVNVLVH
FT                   VYTSVQAGSGMDNFDSDGFATSALLPILVAGGQWWRLVTSGFLHIGLPHLAMNMIALWV
FT                   IGRDLELVLGRLRFTAVYFLSLLGGSTAVFVFGELVQPVAGASGAVYGLMGGIAVAALR
FT                   LKVSLRPVLIVIGLNVLLSVTIPGLSLLGHLGGLFVGAAATAALVYAPRQRRLLFQGGA
FT                   LAAIFLVLAVALVTKDMSLGNMVCTGYGGAGTRCAVG"
     MGYHCVDCVQ AGRGGTRQAV TVAGARLAAK PVVVPVLIAV NVLVHVYTSV QAGSGMDNFD        60
     SDGFATSALL PILVAGGQWW RLVTSGFLHI GLPHLAMNMI ALWVIGRDLE LVLGRLRFTA       120
     VYFLSLLGGS TAVFVFGELV QPVAGASGAV YGLMGGIAVA ALRLKVSLRP VLIVIGLNVL       180
     LSVTIPGLSL LGHLGGLFVG AAATAALVYA PRQRRLLFQG GALAAIFLVL AVALVTKDMS       240
     LGNMVCTGYG GAGTRCAVG                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page