(data stored in ACNUC1104 zone)

EMBL: AM420293.PE332

AM420293.PE332       Location/Qualifiers
FT   CDS             374760..375518
FT                   /transl_table=11
FT                   /locus_tag="SACE_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99687"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6L3"
FT                   /protein_id="CAL99687.1"
FT                   /translation="MNAQESLLPLLELDGVAEAVTSARAAIDEVHRHPANRRGWPTTAA
FT                   EASVRAARASAAVAGGATEIPETGEVSDPLLAGALRIAEGMGPLLPTWQRAPLQALARL
FT                   HVLAAADLVEDKESLGRPRADREVSERLDLLARIVADSSGKSQGVIPGPVLAAVVHGEL
FT                   LALSPFGLADGVIARAAARLTVIGSGLDPKGLVVPEVAYFRRQGDYSAAADGFANGDPE
FT                   GVGEWLHYCCRALEAGAREAKSIADAVQDA"
     MNAQESLLPL LELDGVAEAV TSARAAIDEV HRHPANRRGW PTTAAEASVR AARASAAVAG        60
     GATEIPETGE VSDPLLAGAL RIAEGMGPLL PTWQRAPLQA LARLHVLAAA DLVEDKESLG       120
     RPRADREVSE RLDLLARIVA DSSGKSQGVI PGPVLAAVVH GELLALSPFG LADGVIARAA       180
     ARLTVIGSGL DPKGLVVPEV AYFRRQGDYS AAADGFANGD PEGVGEWLHY CCRALEAGAR       240
     EAKSIADAVQ DA                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page