(data stored in ACNUC1104 zone)

EMBL: AM420293.PE336

AM420293.PE336       Location/Qualifiers
FT   CDS             complement(377628..378974)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0342"
FT                   /product="mandelate racemase/muconate lactonizing enzyme"
FT                   /function="L-alanine-DL-glutamate epimerase"
FT                   /EC_number="4.2.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99691"
FT                   /db_xref="GOA:A4F6L7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR017653"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6L7"
FT                   /protein_id="CAL99691.1"
FT                   /translation="MNTTTTQQSPVVTGMRVVPVAGRDSMLLNLSGAHAPHFTRNLLIL
FT                   TDSAGNTGVGEVPGGEGIRATLTDATDLVVGAPIARYHSVLTHVHRRFADRDSGGRGAQ
FT                   TFDLRVAVHAVTAVEAAMLDLLGKHLGVPVAELLGDGQQRESVPVLGYLFFVGDRNRTD
FT                   LGYRSGAEESDDWLRLRDEEALTSDAVVRLAEAAQARYGFHDFKLKGGVLPGREEAEVV
FT                   TALAERFPEARITLDPNGGWLLSDAIELGRDLYGVLAYAEDPCGPEGGYSGRETMAEFR
FT                   RATGLPTATNMIATDWRQLGHAVRTDAVDIPLADPHFWTMGGSVRVAQLCDAWGLTWGS
FT                   HSNNHFDVSLAMFTHVAAAAPGDITAIDTHWIWQDGQRLTREPFRISDGRIEVPTAPGL
FT                   GVELDMEQVEAAHALYLTEGLGTRDDAVAMRYLVPGWTFDSKRPALDRP"
     MNTTTTQQSP VVTGMRVVPV AGRDSMLLNL SGAHAPHFTR NLLILTDSAG NTGVGEVPGG        60
     EGIRATLTDA TDLVVGAPIA RYHSVLTHVH RRFADRDSGG RGAQTFDLRV AVHAVTAVEA       120
     AMLDLLGKHL GVPVAELLGD GQQRESVPVL GYLFFVGDRN RTDLGYRSGA EESDDWLRLR       180
     DEEALTSDAV VRLAEAAQAR YGFHDFKLKG GVLPGREEAE VVTALAERFP EARITLDPNG       240
     GWLLSDAIEL GRDLYGVLAY AEDPCGPEGG YSGRETMAEF RRATGLPTAT NMIATDWRQL       300
     GHAVRTDAVD IPLADPHFWT MGGSVRVAQL CDAWGLTWGS HSNNHFDVSL AMFTHVAAAA       360
     PGDITAIDTH WIWQDGQRLT REPFRISDGR IEVPTAPGLG VELDMEQVEA AHALYLTEGL       420
     GTRDDAVAMR YLVPGWTFDS KRPALDRP                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page