(data stored in ACNUC1104 zone)

EMBL: AM420293.PE343

AM420293.PE343       Location/Qualifiers
FT   CDS             385521..386045
FT                   /transl_table=11
FT                   /locus_tag="SACE_0349"
FT                   /product="cysteine dioxygenase type I"
FT                   /function="predicted metal-dependent enzyme of the
FT                   double-stranded beta helix superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99698"
FT                   /db_xref="GOA:A4F6M4"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M4"
FT                   /protein_id="CAL99698.1"
FT                   /translation="MTPQQIHLVQAIRDVVRREERAERTAELVAEALRPFLAVPDLLRE
FT                   DQRTGDPGSYTQHVLHVEPDGSFSVVALVWLPGQRTPVHDHVAWCVTGVYEGVEHEQRF
FT                   TVHDGSSLVPTQQVTNPAGDVCGFAPPGDIHLVRNACTTKAISLHVYGADIGTLGTSVR
FT                   RTYDLPVRAAV"
     MTPQQIHLVQ AIRDVVRREE RAERTAELVA EALRPFLAVP DLLREDQRTG DPGSYTQHVL        60
     HVEPDGSFSV VALVWLPGQR TPVHDHVAWC VTGVYEGVEH EQRFTVHDGS SLVPTQQVTN       120
     PAGDVCGFAP PGDIHLVRNA CTTKAISLHV YGADIGTLGT SVRRTYDLPV RAAV             174
//

If you have problems or comments...

PBIL Back to PBIL home page