(data stored in ACNUC1104 zone)

EMBL: AM420293.PE344

AM420293.PE344       Location/Qualifiers
FT   CDS             complement(386052..386840)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99699"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M5"
FT                   /protein_id="CAL99699.1"
FT                   /translation="MSERWRLPPLWFELCWEVGGFGDRPIPVGGSTDEWTPQERVVLRQ
FT                   RALAGMRAAGLLSGDVLAPALAQALAQIARPCLWIDGAWLPVAGSPPARLLSVVAGSGT
FT                   VLLVSGGADAQDVDISVHPRTSISAAAARGIPQAPPGLRAFVSVPASAFEPWEEDSESV
FT                   GGGPGDAGGGGPGSEPTLREMIDAPHFREGRFTANLRARSGRTHRSQPLNWFDAFQPDG
FT                   RYRLRHGLGRRNELGLTPLSPADITHALDRRIAAVVRAGG"
     MSERWRLPPL WFELCWEVGG FGDRPIPVGG STDEWTPQER VVLRQRALAG MRAAGLLSGD        60
     VLAPALAQAL AQIARPCLWI DGAWLPVAGS PPARLLSVVA GSGTVLLVSG GADAQDVDIS       120
     VHPRTSISAA AARGIPQAPP GLRAFVSVPA SAFEPWEEDS ESVGGGPGDA GGGGPGSEPT       180
     LREMIDAPHF REGRFTANLR ARSGRTHRSQ PLNWFDAFQP DGRYRLRHGL GRRNELGLTP       240
     LSPADITHAL DRRIAAVVRA GG                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page