(data stored in SCRATCH zone)

EMBL: AM420293.PE349

AM420293.PE349       Location/Qualifiers
FT   CDS             391607..393388
FT                   /transl_table=11
FT                   /locus_tag="SACE_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99704"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N0"
FT                   /protein_id="CAL99704.1"
FT                   /translation="MTPEPLPPTSFCAAGHASASLLEHERTLVALHESGALRLIDGGRE
FT                   GSGRRWRMSWGHGSSAVRAMVGVRESATDDGEVTFWVHAEARRPWSIRDQRNPVERMGL
FT                   LDHGLKDPSSAYSLTQQNPLFGLREVGFLEHTFSRDMRDSPVLVYHDEPGARPSQEMRR
FT                   FRNATRGMCGLLPVDDAVRERVNDLVPADRRIPHRAVRLYVPPWWAGHEEDITVEVSRL
FT                   DRPGVWRRIVDTVIRVSSWRGGGKIRATAREWSALLDDPMNDVRIVPATRGGDVRWLPA
FT                   PDDSGKRILRRRLDAVTEQARTARDEADSAAESVARRRATLDALTAQVALARRSRRRLA
FT                   ELTLRLRQERDSAEAALRTGSVAAAWREAREAELEAELYAEELDRVDDEVVAQRSRARA
FT                   AAGGGAARGAEPAEPDGGGARAARSAPSFTGFGELLAAAERELAGLRLGPQTAVAVELD
FT                   GHLRSALWRRRTWDVLELLSAYALRRRAADGGEPCLRGFSYYVREFGGTRGISPSLVAS
FT                   GESEMVANTPRFRNARTFAVPPEVHRSGWEFFGAHVKIDRGGGVAPRLHYFDDTRGPTG
FT                   EVHIGYLGPHLPSPESN"
     MTPEPLPPTS FCAAGHASAS LLEHERTLVA LHESGALRLI DGGREGSGRR WRMSWGHGSS        60
     AVRAMVGVRE SATDDGEVTF WVHAEARRPW SIRDQRNPVE RMGLLDHGLK DPSSAYSLTQ       120
     QNPLFGLREV GFLEHTFSRD MRDSPVLVYH DEPGARPSQE MRRFRNATRG MCGLLPVDDA       180
     VRERVNDLVP ADRRIPHRAV RLYVPPWWAG HEEDITVEVS RLDRPGVWRR IVDTVIRVSS       240
     WRGGGKIRAT AREWSALLDD PMNDVRIVPA TRGGDVRWLP APDDSGKRIL RRRLDAVTEQ       300
     ARTARDEADS AAESVARRRA TLDALTAQVA LARRSRRRLA ELTLRLRQER DSAEAALRTG       360
     SVAAAWREAR EAELEAELYA EELDRVDDEV VAQRSRARAA AGGGAARGAE PAEPDGGGAR       420
     AARSAPSFTG FGELLAAAER ELAGLRLGPQ TAVAVELDGH LRSALWRRRT WDVLELLSAY       480
     ALRRRAADGG EPCLRGFSYY VREFGGTRGI SPSLVASGES EMVANTPRFR NARTFAVPPE       540
     VHRSGWEFFG AHVKIDRGGG VAPRLHYFDD TRGPTGEVHI GYLGPHLPSP ESN              593
//

If you have problems or comments...

PBIL Back to PBIL home page