(data stored in SCRATCH zone)

EMBL: AM420293.PE351

AM420293.PE351       Location/Qualifiers
FT   CDS             complement(393881..394384)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99706"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N2"
FT                   /protein_id="CAL99706.1"
FT                   /translation="MDPAPFRTDVSLHRNGTGRPTLRFERHYRHPKEQVWRALTEEAEL
FT                   AAWFPCAARIDATPGGTATFTFPGAPPQSGEVLAAEPPRSLDFTWHGETLRWRLADAPG
FT                   GCLLRLDIENQDPAHAAQSAAGYDLCLDQLATLLDAGSVRRVEMPPPREIVQHYADAFS
FT                   VPDA"
     MDPAPFRTDV SLHRNGTGRP TLRFERHYRH PKEQVWRALT EEAELAAWFP CAARIDATPG        60
     GTATFTFPGA PPQSGEVLAA EPPRSLDFTW HGETLRWRLA DAPGGCLLRL DIENQDPAHA       120
     AQSAAGYDLC LDQLATLLDA GSVRRVEMPP PREIVQHYAD AFSVPDA                     167
//

If you have problems or comments...

PBIL Back to PBIL home page