(data stored in ACNUC1104 zone)

EMBL: AM420293.PE353

AM420293.PE353       Location/Qualifiers
FT   CDS             complement(395016..395408)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0359"
FT                   /product="pyridoxamine 5'-phosphate
FT                   oxidase-related,FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99708"
FT                   /db_xref="GOA:A4F6N4"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N4"
FT                   /protein_id="CAL99708.1"
FT                   /translation="MAVIPQDREDILNKRAFAHVATIGPRGEPQSSPVWIGWDGTHIKF
FT                   SQTKTRQKYRNLQRDARISMSLHDPDQPYRYLEVRGEVVRVEDDQDDAFINSMAKKYLG
FT                   EDTYPWARPGEERIVLYVEPRHCTKQ"
     MAVIPQDRED ILNKRAFAHV ATIGPRGEPQ SSPVWIGWDG THIKFSQTKT RQKYRNLQRD        60
     ARISMSLHDP DQPYRYLEVR GEVVRVEDDQ DDAFINSMAK KYLGEDTYPW ARPGEERIVL       120
     YVEPRHCTKQ                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page