(data stored in ACNUC1104 zone)

EMBL: AM420293.PE354

AM420293.PE354       Location/Qualifiers
FT   CDS             complement(395736..396272)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99709"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N5"
FT                   /protein_id="CAL99709.1"
FT                   /translation="MPTLVRAVADDRDGLIAFLEEQRASLRRAVHGLDDEQAAARPVPS
FT                   SELCLGGLVKHVANAERNWVDVVAGRPSPARDWSSEFGMAPEETLADLLTRYRKISDET
FT                   AAVFAGISDLDRPLDIGPLSALIPSGTERTPRWVLSHLIQETARHAGHADILREALDGS
FT                   TAADLLQATGTPLFG"
     MPTLVRAVAD DRDGLIAFLE EQRASLRRAV HGLDDEQAAA RPVPSSELCL GGLVKHVANA        60
     ERNWVDVVAG RPSPARDWSS EFGMAPEETL ADLLTRYRKI SDETAAVFAG ISDLDRPLDI       120
     GPLSALIPSG TERTPRWVLS HLIQETARHA GHADILREAL DGSTAADLLQ ATGTPLFG         178
//

If you have problems or comments...

PBIL Back to PBIL home page