(data stored in ACNUC1104 zone)

EMBL: AM420293.PE360

AM420293.PE360       Location/Qualifiers
FT   CDS             404965..406098
FT                   /transl_table=11
FT                   /locus_tag="SACE_0367"
FT                   /product="type II secretion system protein E"
FT                   /function="Flp pilus assembly protein, ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99715"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P1"
FT                   /protein_id="CAL99715.1"
FT                   /translation="MRNRLAGSGVPLTSSAVATAVRAEAGGLVGDADVLDRLRQVQREF
FT                   LGAGALEPLLRDPAVTDVLVTAPDAVWVDQGDGLRRCTETFADEDAVRRLAQRLALASG
FT                   RRLDDAQPWVDAWLPRATGAVRLHAVLPPVADSTCISLRVLRPAVHGLDSLHGKDMFDA
FT                   PTAELLRSIIATRLAFLVVGGAGAGKTTLLAAMLGEVSPAERIICVEEASELQPDHPHV
FT                   VRLLTRPPNIEGAGEIQVRDLVRQALRMRPDRLVVGEVRGGEICELLAALNTGHEGGGG
FT                   TLHANSPREVPARMEALAALGGLSRAALHSQLAAAVQVVLHVQRTRQGRRLAAVGVPFR
FT                   VGDHIEVRPAWEQHSGWGPGAEALAAMLSARGGALPC"
     MRNRLAGSGV PLTSSAVATA VRAEAGGLVG DADVLDRLRQ VQREFLGAGA LEPLLRDPAV        60
     TDVLVTAPDA VWVDQGDGLR RCTETFADED AVRRLAQRLA LASGRRLDDA QPWVDAWLPR       120
     ATGAVRLHAV LPPVADSTCI SLRVLRPAVH GLDSLHGKDM FDAPTAELLR SIIATRLAFL       180
     VVGGAGAGKT TLLAAMLGEV SPAERIICVE EASELQPDHP HVVRLLTRPP NIEGAGEIQV       240
     RDLVRQALRM RPDRLVVGEV RGGEICELLA ALNTGHEGGG GTLHANSPRE VPARMEALAA       300
     LGGLSRAALH SQLAAAVQVV LHVQRTRQGR RLAAVGVPFR VGDHIEVRPA WEQHSGWGPG       360
     AEALAAMLSA RGGALPC                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page