(data stored in SCRATCH zone)

EMBL: AM420293.PE361

AM420293.PE361       Location/Qualifiers
FT   CDS             406092..406895
FT                   /transl_table=11
FT                   /locus_tag="SACE_0368"
FT                   /product="type II secretion system protein"
FT                   /function="Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99716"
FT                   /db_xref="GOA:A4F6P2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P2"
FT                   /protein_id="CAL99716.1"
FT                   /translation="MLTFLLLALSLLCWPDLRAQRRLGALTSTTSWSSGAMVVRVARIG
FT                   WIPVAAALGALLAGVGGLFAAVALAVLGRRYVRSRRSFRVGVERSAELSGGIRLLVAGL
FT                   RAGAHPAVAAEGAAADSAPAISGVFRDLASAAKLGGDIPTVLDNGGHPAELRQPLARLG
FT                   RAWRLAERHGVALADLLDAVRRDVDHRVAFIRDLESKMAGPRATAAMLAGLPLLGLLLG
FT                   EAVGAAPLAVLTGQAFGQAVLVVGVALLCAGLFWTLRLTEGAISP"
     MLTFLLLALS LLCWPDLRAQ RRLGALTSTT SWSSGAMVVR VARIGWIPVA AALGALLAGV        60
     GGLFAAVALA VLGRRYVRSR RSFRVGVERS AELSGGIRLL VAGLRAGAHP AVAAEGAAAD       120
     SAPAISGVFR DLASAAKLGG DIPTVLDNGG HPAELRQPLA RLGRAWRLAE RHGVALADLL       180
     DAVRRDVDHR VAFIRDLESK MAGPRATAAM LAGLPLLGLL LGEAVGAAPL AVLTGQAFGQ       240
     AVLVVGVALL CAGLFWTLRL TEGAISP                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page