(data stored in ACNUC1104 zone)

EMBL: AM420293.PE362

AM420293.PE362       Location/Qualifiers
FT   CDS             407768..408199
FT                   /transl_table=11
FT                   /locus_tag="SACE_0369"
FT                   /product="type II secretion system protein"
FT                   /function="Flp pilus assembly protein TadC"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99717"
FT                   /db_xref="GOA:A4F6P3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P3"
FT                   /protein_id="CAL99717.1"
FT                   /translation="MLAAGWDLLAAGMRAGLPVPVILRAVAAEFDGAPAGVLDEVARLL
FT                   ALGADAVAAWEPALRHPDTEELARAARRTARTGTGLADVAADLAADARASVGARAQAHA
FT                   QRATVWVALPLGLCFLPAFLCLGVLPVVAGMLNRIVATW"
     MLAAGWDLLA AGMRAGLPVP VILRAVAAEF DGAPAGVLDE VARLLALGAD AVAAWEPALR        60
     HPDTEELARA ARRTARTGTG LADVAADLAA DARASVGARA QAHAQRATVW VALPLGLCFL       120
     PAFLCLGVLP VVAGMLNRIV ATW                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page