(data stored in SCRATCH zone)

EMBL: AM420293.PE365

AM420293.PE365       Location/Qualifiers
FT   CDS             410726..411382
FT                   /transl_table=11
FT                   /locus_tag="SACE_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99720"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P6"
FT                   /protein_id="CAL99720.1"
FT                   /translation="MDWSADEWQDAIGGVRALQAGLLNNRIELRVEAIGFASRGWPVLP
FT                   GTYPVGTRWIGRDGGEADGPMPVHQDWEERLGTNPDQVAAWWSGRPHSLLLATGTAVNA
FT                   VEVDAALGYRAAVALRTLGFPVPIVAVPNGRWYFLTSGGDRLAPELADLTEVRLHGAGS
FT                   WVPMPPTTYPHGAAHWRVKPEVCGWTLPSLDFVQDALVQGLNQDHNVADLVAAGG"
     MDWSADEWQD AIGGVRALQA GLLNNRIELR VEAIGFASRG WPVLPGTYPV GTRWIGRDGG        60
     EADGPMPVHQ DWEERLGTNP DQVAAWWSGR PHSLLLATGT AVNAVEVDAA LGYRAAVALR       120
     TLGFPVPIVA VPNGRWYFLT SGGDRLAPEL ADLTEVRLHG AGSWVPMPPT TYPHGAAHWR       180
     VKPEVCGWTL PSLDFVQDAL VQGLNQDHNV ADLVAAGG                               218
//

If you have problems or comments...

PBIL Back to PBIL home page