(data stored in SCRATCH zone)

EMBL: AM420293.PE367

AM420293.PE367       Location/Qualifiers
FT   CDS             414082..414582
FT                   /transl_table=11
FT                   /locus_tag="SACE_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99722"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P8"
FT                   /protein_id="CAL99722.1"
FT                   /translation="MTRHFAGSRGGWTGRCGSGGDARTRSRSRPRFSTPCWRPCPKRYT
FT                   ARGRRVGIGWTRGCPWRHAVRVRRIGIGWPTTAPGAPHRRGRRTDNRCASAPPVAPRRS
FT                   GPSYRRRLANDGARSAARRAAASPSIASACAAAIRHRGAMRRALGAGCPRQTLPPHPYR
FT                   EPA"
     MTRHFAGSRG GWTGRCGSGG DARTRSRSRP RFSTPCWRPC PKRYTARGRR VGIGWTRGCP        60
     WRHAVRVRRI GIGWPTTAPG APHRRGRRTD NRCASAPPVA PRRSGPSYRR RLANDGARSA       120
     ARRAAASPSI ASACAAAIRH RGAMRRALGA GCPRQTLPPH PYREPA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page