(data stored in SCRATCH zone)

EMBL: AM420293.PE371

AM420293.PE371       Location/Qualifiers
FT   CDS             421334..421684
FT                   /transl_table=11
FT                   /locus_tag="SACE_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99726"
FT                   /db_xref="GOA:A4F6Q2"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q2"
FT                   /protein_id="CAL99726.1"
FT                   /translation="MRDALSGPDGTQPLAPPPTYPDVLGGGEIVRSHIRPAQPVAPPRL
FT                   TEHERAAAVRPRRAARHPAKQTEVRVEPASDQRAGGVAGKVVGCLTMLVVLGGIALGVV
FT                   HRLLVEYGILGP"
     MRDALSGPDG TQPLAPPPTY PDVLGGGEIV RSHIRPAQPV APPRLTEHER AAAVRPRRAA        60
     RHPAKQTEVR VEPASDQRAG GVAGKVVGCL TMLVVLGGIA LGVVHRLLVE YGILGP           116
//

If you have problems or comments...

PBIL Back to PBIL home page