(data stored in ACNUC1104 zone)

EMBL: AM420293.PE374

AM420293.PE374       Location/Qualifiers
FT   CDS             complement(423996..425381)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99729"
FT                   /db_xref="GOA:A4F6Q5"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Q5"
FT                   /protein_id="CAL99729.1"
FT                   /translation="MRRLAVCTTASLAVAGLSLPAALAPEALLSDALAQESTLPTTPRP
FT                   SPHDPTQPPESVPVPQPGPIVADAGTGIGMIRILPKTVPTGTILDNPAFEESLPKQALA
FT                   ELGMGLASAQANSGAYLAHERAVADAQPFGFAVQGKAPRSPLSLSQTAVPDHAEPTVNE
FT                   LQPPASPLDGLVKLGVLEGSAHARWDKVLGPCVEPIADARTSLAGVSAGNALPSFPAEL
FT                   TGLTGAAGGASLLNVPNAMQAHSNVRLVDVPGQRGKAVRATSRMSVASVRLFAGTDREL
FT                   RIDVISEPTLTATSTGDPMTSTVEYQAPVLRISQGGEEIGTIDAAKPRMDLPFDPRKLD
FT                   LGVVRLSIGELRQDVVGSEVRAGARMFDLHILPADRLGIPTSLAQISFGEQVARAGAPE
FT                   GGVVCEAAPATNPDPAPIAEGPKAPPLALTSGAYSAVPLFWTGTAMLLLGTILVAAMPR
FT                   RRN"
     MRRLAVCTTA SLAVAGLSLP AALAPEALLS DALAQESTLP TTPRPSPHDP TQPPESVPVP        60
     QPGPIVADAG TGIGMIRILP KTVPTGTILD NPAFEESLPK QALAELGMGL ASAQANSGAY       120
     LAHERAVADA QPFGFAVQGK APRSPLSLSQ TAVPDHAEPT VNELQPPASP LDGLVKLGVL       180
     EGSAHARWDK VLGPCVEPIA DARTSLAGVS AGNALPSFPA ELTGLTGAAG GASLLNVPNA       240
     MQAHSNVRLV DVPGQRGKAV RATSRMSVAS VRLFAGTDRE LRIDVISEPT LTATSTGDPM       300
     TSTVEYQAPV LRISQGGEEI GTIDAAKPRM DLPFDPRKLD LGVVRLSIGE LRQDVVGSEV       360
     RAGARMFDLH ILPADRLGIP TSLAQISFGE QVARAGAPEG GVVCEAAPAT NPDPAPIAEG       420
     PKAPPLALTS GAYSAVPLFW TGTAMLLLGT ILVAAMPRRR N                           461
//

If you have problems or comments...

PBIL Back to PBIL home page