(data stored in ACNUC1104 zone)

EMBL: AM420293.PE385

AM420293.PE385       Location/Qualifiers
FT   CDS             437872..441666
FT                   /transl_table=11
FT                   /locus_tag="SACE_0392"
FT                   /product="hypothetical protein"
FT                   /function="D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 4)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99740"
FT                   /db_xref="GOA:A4F6R6"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R6"
FT                   /protein_id="CAL99740.1"
FT                   /translation="MPDPQTTRGEVSEPEAEPQADATGAGASDATASGASSAKTQTRTG
FT                   TLDDVTADAAGGEAAGAEEDGGDDAEKSADEGESSGTTGGDDDRTAADDDAAEGEAAGA
FT                   GDQGADSEAGESGSANGGGQLRGRFKGQFTAGGPMNGQLTGQLTGRMDGPMSGRIDGQI
FT                   DTEKSEEAGKSEQADASGESDDAVESDQAGKSGEAAERGSDEATTEPEDSGDEADDSGA
FT                   DSAEAAEDAETDEPAEAAEAAESAADAGESADASEEQPTESAASEDAGSAEDGEADESS
FT                   AGEREDAQTAAGEDADAADQSVTADDSTADETEAADDEAGESETSSTDTVALGTVQPES
FT                   DEDGETSESGTAEWEAESEAGETEASETGPAEDESSEAEVADEAEAAEEAEAADTAAEP
FT                   ETADSAAAETTSATESDSPEPESESSEPESDEAETAEPTPDSEAAEDEPAQAEAAPSPE
FT                   EPEAVADEDAETEAAGTETAAEAGTAAERDADEWPTDEHERVEAEPETREPVEQAEEAE
FT                   ESAEPAAEEPAQAAVEEPGLTAPGEPEAAPAEPEQATAPEAEQAAPAEPEQSEQAPEES
FT                   EQAADQQAPAVEPEQQRPAAPPERSVEQTQQFRPVEQTQWIPRIEQTQQIQRIEPEREE
FT                   PAEATSGEDAGPPTDPGPSKPSPQLDQGPPTMRIPAVGAAPSVDGPPTQRIPLVPPPGS
FT                   AEQTQQFARPDFSSPPRSAQPQDFDTSSARTAQPHDFAGLTGPAPAPAAPQVPQPPDVT
FT                   RQAPAPTHQPPPAPAQQSYVPGATQPVAKPAPEASPEPHPAEPPAEPSAAAPAKRRKRR
FT                   GTLITVALLLVVGLGAGIAFGPALVRALTEAQIAEPPAPVRLQPSIKPLDDGAPLPRQQ
FT                   RVSAALAGPLANPALGTFGGTVIDAQTGAPVWQQSPGQALTPASTGKLLTMSAALLALD
FT                   HQQRFSTKVVRGPEPGSVVLVGGGDPTLSTLGPGEDTVYTGAARIDDLAEQVRKATGGS
FT                   VSRIYVDVGRYSGPKMAPGWLPEDVQAGYVAPMEPLMLNGGRADPTKDTSPRTQTPALQ
FT                   AGQRLASKLGTGSVQEGNAPVNAQVLGEVKSPPVQDMAEIVLQHSDNVLAEALAREVAI
FT                   ATGNEPSFAGASKAVREVLQRNGFDLSGNTMVDGSGLSLDDRVTPQLLGSLLAAATAPA
FT                   GPEGGLEPKSAKLRALLPGLPVAAGSGSLHDRYTDSSGRGWVRAKTGTLDGANSLAGTV
FT                   VTENGRLLVFALMSNGTMSAQARPALDDLAIALRDCGCD"
     MPDPQTTRGE VSEPEAEPQA DATGAGASDA TASGASSAKT QTRTGTLDDV TADAAGGEAA        60
     GAEEDGGDDA EKSADEGESS GTTGGDDDRT AADDDAAEGE AAGAGDQGAD SEAGESGSAN       120
     GGGQLRGRFK GQFTAGGPMN GQLTGQLTGR MDGPMSGRID GQIDTEKSEE AGKSEQADAS       180
     GESDDAVESD QAGKSGEAAE RGSDEATTEP EDSGDEADDS GADSAEAAED AETDEPAEAA       240
     EAAESAADAG ESADASEEQP TESAASEDAG SAEDGEADES SAGEREDAQT AAGEDADAAD       300
     QSVTADDSTA DETEAADDEA GESETSSTDT VALGTVQPES DEDGETSESG TAEWEAESEA       360
     GETEASETGP AEDESSEAEV ADEAEAAEEA EAADTAAEPE TADSAAAETT SATESDSPEP       420
     ESESSEPESD EAETAEPTPD SEAAEDEPAQ AEAAPSPEEP EAVADEDAET EAAGTETAAE       480
     AGTAAERDAD EWPTDEHERV EAEPETREPV EQAEEAEESA EPAAEEPAQA AVEEPGLTAP       540
     GEPEAAPAEP EQATAPEAEQ AAPAEPEQSE QAPEESEQAA DQQAPAVEPE QQRPAAPPER       600
     SVEQTQQFRP VEQTQWIPRI EQTQQIQRIE PEREEPAEAT SGEDAGPPTD PGPSKPSPQL       660
     DQGPPTMRIP AVGAAPSVDG PPTQRIPLVP PPGSAEQTQQ FARPDFSSPP RSAQPQDFDT       720
     SSARTAQPHD FAGLTGPAPA PAAPQVPQPP DVTRQAPAPT HQPPPAPAQQ SYVPGATQPV       780
     AKPAPEASPE PHPAEPPAEP SAAAPAKRRK RRGTLITVAL LLVVGLGAGI AFGPALVRAL       840
     TEAQIAEPPA PVRLQPSIKP LDDGAPLPRQ QRVSAALAGP LANPALGTFG GTVIDAQTGA       900
     PVWQQSPGQA LTPASTGKLL TMSAALLALD HQQRFSTKVV RGPEPGSVVL VGGGDPTLST       960
     LGPGEDTVYT GAARIDDLAE QVRKATGGSV SRIYVDVGRY SGPKMAPGWL PEDVQAGYVA      1020
     PMEPLMLNGG RADPTKDTSP RTQTPALQAG QRLASKLGTG SVQEGNAPVN AQVLGEVKSP      1080
     PVQDMAEIVL QHSDNVLAEA LAREVAIATG NEPSFAGASK AVREVLQRNG FDLSGNTMVD      1140
     GSGLSLDDRV TPQLLGSLLA AATAPAGPEG GLEPKSAKLR ALLPGLPVAA GSGSLHDRYT      1200
     DSSGRGWVRA KTGTLDGANS LAGTVVTENG RLLVFALMSN GTMSAQARPA LDDLAIALRD      1260
     CGCD                                                                   1264
//

If you have problems or comments...

PBIL Back to PBIL home page