(data stored in ACNUC1104 zone)

EMBL: AM420293.PE386

AM420293.PE386       Location/Qualifiers
FT   CDS             441855..442823
FT                   /transl_table=11
FT                   /locus_tag="SACE_0393"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99741"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R7"
FT                   /protein_id="CAL99741.1"
FT                   /translation="MRSLRRYSVEAETHVRELTGLGTHLPVLEGDVVDRPDWVRGAAHG
FT                   LAELTDAALSNAHGVQREGLDLLGGISTRGAGVQAGIVLAYLGGKVLGQYDPFGPTASG
FT                   QPGRLLLVAPNIVAAHQALEVPGEDFRMWVCLHESTHRLQFTAVPWLRDHFAASLGTLL
FT                   SEMEGTTSDLLGRLPAVVREVRSGRGGDSSPGVLGVIELLQTPRQRAALDRIIAISTLL
FT                   EGHADHVMDAVGPRVVPSVATIRQRFTERRKGGGLLDRILRSLLGVDAKIHQYAQGAAF
FT                   TRHVVDQVGMEGFNAVWAAPDHLPTRAEITAPATWLRRVHG"
     MRSLRRYSVE AETHVRELTG LGTHLPVLEG DVVDRPDWVR GAAHGLAELT DAALSNAHGV        60
     QREGLDLLGG ISTRGAGVQA GIVLAYLGGK VLGQYDPFGP TASGQPGRLL LVAPNIVAAH       120
     QALEVPGEDF RMWVCLHEST HRLQFTAVPW LRDHFAASLG TLLSEMEGTT SDLLGRLPAV       180
     VREVRSGRGG DSSPGVLGVI ELLQTPRQRA ALDRIIAIST LLEGHADHVM DAVGPRVVPS       240
     VATIRQRFTE RRKGGGLLDR ILRSLLGVDA KIHQYAQGAA FTRHVVDQVG MEGFNAVWAA       300
     PDHLPTRAEI TAPATWLRRV HG                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page