(data stored in ACNUC1104 zone)

EMBL: AM420293.PE387

AM420293.PE387       Location/Qualifiers
FT   CDS             443116..444108
FT                   /transl_table=11
FT                   /locus_tag="SACE_0394"
FT                   /product="cell cycle protein MesJ"
FT                   /function="predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99742"
FT                   /db_xref="GOA:A4F6R8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6R8"
FT                   /protein_id="CAL99742.1"
FT                   /translation="MPPTAAVTATRAAVRRLLGSAEASPSAPLGAVAVACSGGADSLAL
FT                   AAATTHVARRRDIAVHGLVVDHGLQEGSADVASRAAEQLEELGCDVVRVLPVEIGREGG
FT                   PEAAARRARYAALDAARPAGAPVLLGHTRDDQAETVLLGLGRGSGARSIAGMRPVDLPW
FT                   LRPFLDVTRDTTLAACEALGLRPWQDPHNSDAKFTRVRLRAEVLPLLEEVLQGGVASAL
FT                   ARTAVQLREDADALDEVAADVRKRVEDGDALDAAALSAGPPAVRRRVLRGWLLDQGVRE
FT                   VSDAHLRAADALVGHWKGQGPHALPGGFVLRRTHGTLRVEVAVKQPPDY"
     MPPTAAVTAT RAAVRRLLGS AEASPSAPLG AVAVACSGGA DSLALAAATT HVARRRDIAV        60
     HGLVVDHGLQ EGSADVASRA AEQLEELGCD VVRVLPVEIG REGGPEAAAR RARYAALDAA       120
     RPAGAPVLLG HTRDDQAETV LLGLGRGSGA RSIAGMRPVD LPWLRPFLDV TRDTTLAACE       180
     ALGLRPWQDP HNSDAKFTRV RLRAEVLPLL EEVLQGGVAS ALARTAVQLR EDADALDEVA       240
     ADVRKRVEDG DALDAAALSA GPPAVRRRVL RGWLLDQGVR EVSDAHLRAA DALVGHWKGQ       300
     GPHALPGGFV LRRTHGTLRV EVAVKQPPDY                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page